Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TNR12 protein (Active)

This Human TNR12 protein (Active) spans the amino acid sequence from region 28-80aa. Purity: > 95% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Fibroblast growth factor-inducible immediate-early response protein 14, Tweak-receptor, TweakR, CD antigen CD266

UniProt

Q9NP84

Expression Region

28-80aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 95% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by inhibiting TWEAK- dependent proliferation of human umbilical vein endothelial cells (HUVEC) is less than 30 ng/ml, corresponding to a specific activity of > 3.3 x 10 ^ 4 IU/mg, in the presence of 15 ng/ml of rHuTWEAK.

Form

Lyophilized powder

Molecular Weight

5.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

EQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-methylbenzylboronic acid pinacol ester
QPA56412-01 100 mg

3-methylbenzylboronic acid pinacol ester

Sign In for Pricing
View Details
3-methylbenzylboronic acid pinacol ester
QPA56412-02 1 g

3-methylbenzylboronic acid pinacol ester

Sign In for Pricing
View Details
Squamous epithelium, isolated cells from human mouth, smear
Ma111c 7.6 x 2.6 cm

Squamous epithelium, isolated cells from human mouth, smear

Sign In for Pricing
View Details
CNN2 (NM_004368) Human Over-expression Lysate
LS001265 100 µg

CNN2 (NM_004368) Human Over-expression Lysate

Sign In for Pricing
View Details
VTI1B Protein Vector (Human) (pPB-N-His)
PV045962 500 ng

VTI1B Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
3-Phenoxybenzoic acid
C09444 100 mg

3-Phenoxybenzoic acid

Sign In for Pricing
View Details