Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TNR12 protein (Active)

This Human TNR12 protein (Active) spans the amino acid sequence from region 28-80aa. Purity: > 95% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Fibroblast growth factor-inducible immediate-early response protein 14, Tweak-receptor, TweakR, CD antigen CD266

UniProt

Q9NP84

Expression Region

28-80aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 95% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by inhibiting TWEAK- dependent proliferation of human umbilical vein endothelial cells (HUVEC) is less than 30 ng/ml, corresponding to a specific activity of > 3.3 x 10 ^ 4 IU/mg, in the presence of 15 ng/ml of rHuTWEAK.

Form

Lyophilized powder

Molecular Weight

5.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

EQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR176 Antibody
CSB-PA002771-01 50 µg

GPR176 Antibody

Sign In for Pricing
View Details
GPR176 Antibody
CSB-PA002771-02 100 µg

GPR176 Antibody

Sign In for Pricing
View Details
AM 694
FA17342-01 2 mg

AM 694

Sign In for Pricing
View Details
AM 694
FA17342-02 5 mg

AM 694

Sign In for Pricing
View Details
Rat Crtc3 Pre-designed siRNA Set A
SI203283A 1 Each

Rat Crtc3 Pre-designed siRNA Set A

Sign In for Pricing
View Details
FSH beta Recombinant Rabbit mAb, APC-Cy7 conjugated
orb2331010 100 µL

FSH beta Recombinant Rabbit mAb, APC-Cy7 conjugated

Sign In for Pricing
View Details