Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NTF4 protein (Active)

This Human NTF4 protein (Active) spans the amino acid sequence from region 81-210aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

NT-4, NT-5, Neutrophic factor 4

UniProt

P34130

Expression Region

81-210aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by the dose-dependent induction of choline acetyl transferase activity in rat basal forebrain primary septal cell cultures is less than 50 ng/ml, corresponding to a specific activity of > 2.0 x 10 ^ 4 IU/mg

Form

Lyophilized powder

Molecular Weight

14.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 5.5

AA Sequence

M+GVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBMY1A1 Rabbit Polyclonal Antibody
E10G06961 100 µL

RBMY1A1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal LLGL2 Antibody (4G2)
H00003993-M06 0.1 mg

Mouse Monoclonal LLGL2 Antibody (4G2)

Sign In for Pricing
View Details
AMN1 HDR Plasmid (h)
sc-414957-HDR 20 µg

AMN1 HDR Plasmid (h)

Sign In for Pricing
View Details
FAM181B Double Nickase Plasmid (m)
sc-425503-NIC 20 µg

FAM181B Double Nickase Plasmid (m)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Granulocyte Chemotactic Protein 2 (GCP2)
MBS2056649-01 0.1 mL

FITC-Linked Polyclonal Antibody to Granulocyte Chemotactic Protein 2 (GCP2)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Granulocyte Chemotactic Protein 2 (GCP2)
MBS2056649-02 0.2 mL

FITC-Linked Polyclonal Antibody to Granulocyte Chemotactic Protein 2 (GCP2)

Sign In for Pricing
View Details