Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FGF23 protein (Active)

This Human FGF23 protein (Active) spans the amino acid sequence from region 25-251aa. Purity: > 95% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

FGF-23, Tumor-derived hypophosphatemia-inducing factor

UniProt

Q9GZV9

Expression Region

25-251aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 95% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 0.5 μg/ml, corresponding to a specific activity of > 2.0 x 10 ^ 3 IU/mg in the presence of 0.3 μg/ml of rMuKlotho and 10 μg/ml of heparin.

Form

Lyophilized powder

Molecular Weight

25.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

YPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEX3A Rabbit Polyclonal Antibody (Cy7)
orb1073770 100 µL

MEX3A Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
IFN gamma Monoclonal Antibody, FITC Conjugated
bsm-0388M-FITC-TR 20 µL

IFN gamma Monoclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Rabl3 Mouse shRNA Lentiviral Particle (Locus ID 67657)
TL516858V 500 µL Each

Rabl3 Mouse shRNA Lentiviral Particle (Locus ID 67657)

Sign In for Pricing
View Details
LCE2B, CT (LCE2B, LEP10, SPRL1B, XP5, Late cornified envelope protein 2B, Late envelope protein 10, Skin-specific protein Xp5, Small proline-rich-like epidermal differentiation complex protein 1B) (MaxLight 550)
MBS6315455-01 0.1 mL

LCE2B, CT (LCE2B, LEP10, SPRL1B, XP5, Late cornified envelope protein 2B, Late envelope protein 10, Skin-specific protein Xp5, Small proline-rich-like epidermal differentiation complex protein 1B) (MaxLight 550)

Sign In for Pricing
View Details
LCE2B, CT (LCE2B, LEP10, SPRL1B, XP5, Late cornified envelope protein 2B, Late envelope protein 10, Skin-specific protein Xp5, Small proline-rich-like epidermal differentiation complex protein 1B) (MaxLight 550)
MBS6315455-02 5x 0.1 mL

LCE2B, CT (LCE2B, LEP10, SPRL1B, XP5, Late cornified envelope protein 2B, Late envelope protein 10, Skin-specific protein Xp5, Small proline-rich-like epidermal differentiation complex protein 1B) (MaxLight 550)

Sign In for Pricing
View Details
SLC22A20-set siRNA/shRNA/RNAi Lentivector (Human)
43948091 4x 500 ng

SLC22A20-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details