Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat CXCL3 protein (Active)

This Rat CXCL3 protein (Active) spans the amino acid sequence from region 33-101aa. Purity: > 96% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Cytokine-induced neutrophil chemoattractant 2, Macrophage inflammatory protein 2-alpha/beta, MIP2-alpha/beta

UniProt

Q10746

Expression Region

33-101aa

Tag

Tag-Free

Source

E.Coli

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 96% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human CXCR2 transfected murine BaF3 cells is in a concentration range of 5-50 ng/ml.

Form

Lyophilized powder

Molecular Weight

7.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, pH 7.4, 50 mM NaCl

AA Sequence

RELRCQCLKTLPRVDFENIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQAPRLQKIIQKLLKSDKSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC4A2 Blocking Peptide
33R-6496 100 ug

SLC4A2 Blocking Peptide

Sign In for Pricing
View Details
Cptp Mouse qPCR Primer Pair (NM_024472)
MP205640 200 Reactions

Cptp Mouse qPCR Primer Pair (NM_024472)

Sign In for Pricing
View Details
H2AFY2 Peptide - middle region (AAP57282)
AAP57282-100UG 100 µg

H2AFY2 Peptide - middle region (AAP57282)

Sign In for Pricing
View Details
ASCL4 Protein Lysate (Human) with C-Ha Tag
12528031 100 µg

ASCL4 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
BCL2L12 Rabbit Polyclonal Antibody
orb625089-01 50 µg

BCL2L12 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BCL2L12 Rabbit Polyclonal Antibody
orb625089-02 100 µg

BCL2L12 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details