Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SMIM4 protein

This Human SMIM4 protein spans the amino acid sequence from region 1-70aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q8WVI0

Expression Region

1-70aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MFTRAQVRRILQRVPGKQRFGIYRFLPFFFVLGGTMEWIMIKVRVGQETFYDVYRRKASERQYQRRLEDE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRC2 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV621491 1.0 µg DNA

LRRC2 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
MIA2 Polyclonal Antibody
E20-72756 100 µg

MIA2 Polyclonal Antibody

Sign In for Pricing
View Details
GAPDH Antibody, HRP conjugated
A22783-100UG 100 µg

GAPDH Antibody, HRP conjugated

Sign In for Pricing
View Details
BACE1-AS Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV757911 1.0 µg DNA

BACE1-AS Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
RAG2 antibody
BF0694 100 µg

RAG2 antibody

Sign In for Pricing
View Details
Mouse Sideroflexin 1 (SFXN1) Protein
abx167287-01 10 µg

Mouse Sideroflexin 1 (SFXN1) Protein

Sign In for Pricing
View Details