Mouse Tnfrsf14 protein
This Mouse Tnfrsf14 protein spans the amino acid sequence from region 39-207aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Tnfrsf14; Herpesvirus entry mediator; HVEM; TR2; TNF receptor-like molecule; ATAR; another TRAF-associated receptor; Tumor necrosis factor receptor superfamily member 14
UniProt
Q80WM9
Expression Region
39-207aa
Tag
C-terminal Fc-tagged
Source
Mammalian cell
Origin
Mus musculus (Mouse)
Field of Research
Immunology & Inflammation
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
Greater than 95% as determined by SDS-PAGE.
Bioactivity
The ED50 as determined by its ability to bind Human BTLA in functional ELISA is typically 1.17 ug/ml
Form
Lyophilized powder
Molecular Weight
45.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Partial
Preservative
Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
AA Sequence
QPSCRQEEFLVGDECCPMCNPGYHVKQVCSEHTGTVCAPCPPQTYTAHANGLSKCLPCGVCDPDMGLLTWQECSSWKDTVCRCIPGYFCENQDGSHCSTCLQHTTCPPGQRVEKRGTHDQDTVCADCLTGTFSLGGTQEECLPWTNCSAFQQEVRRGTNSTDTTCSSQV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
352440 100 µg
PJA1, NT (Praja Ring Finger 1, E3 Ubiquitin-protein Ligase Praja-1, PRAJA1, Ring Finger Protein 70, RNF70)
Sign In for Pricing
View Details 
EH24428 96 Tests
Human CHRNb3 (Cholinergic Receptor, Nicotinic, Beta 3) ELISA Kit
Sign In for Pricing
View Details MBS6232934-01 0.1 mL
FUCA2 (Fucosidase alpha-L- 2 Plasma, Alpha-L-fucoside Fucohydrolase 2, Alpha-L-fucosidase 2, dJ20N2.5, MGC1314, Plasma alpha-L-fucosidase, PSEC0151, RP1-20N2.5, UNQ227/PRO260) (MaxLight 750)
Sign In for Pricing
View Details MBS6232934-02 5x 0.1 mL
FUCA2 (Fucosidase alpha-L- 2 Plasma, Alpha-L-fucoside Fucohydrolase 2, Alpha-L-fucosidase 2, dJ20N2.5, MGC1314, Plasma alpha-L-fucosidase, PSEC0151, RP1-20N2.5, UNQ227/PRO260) (MaxLight 750)
Sign In for Pricing
View Details 