Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Tnfrsf14 protein

This Mouse Tnfrsf14 protein spans the amino acid sequence from region 39-207aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tnfrsf14; Herpesvirus entry mediator; HVEM; TR2; TNF receptor-like molecule; ATAR; another TRAF-associated receptor; Tumor necrosis factor receptor superfamily member 14

UniProt

Q80WM9

Expression Region

39-207aa

Tag

C-terminal Fc-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined by its ability to bind Human BTLA in functional ELISA is typically 1.17 ug/ml

Form

Lyophilized powder

Molecular Weight

45.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

AA Sequence

QPSCRQEEFLVGDECCPMCNPGYHVKQVCSEHTGTVCAPCPPQTYTAHANGLSKCLPCGVCDPDMGLLTWQECSSWKDTVCRCIPGYFCENQDGSHCSTCLQHTTCPPGQRVEKRGTHDQDTVCADCLTGTFSLGGTQEECLPWTNCSAFQQEVRRGTNSTDTTCSSQV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Multimerin 1 ELISA Kit
MBS764139-01 48 Well

Human Multimerin 1 ELISA Kit

Sign In for Pricing
View Details
Human Multimerin 1 ELISA Kit
MBS764139-02 96 Well

Human Multimerin 1 ELISA Kit

Sign In for Pricing
View Details
Human Multimerin 1 ELISA Kit
MBS764139-03 5x 96 Well

Human Multimerin 1 ELISA Kit

Sign In for Pricing
View Details
Human Multimerin 1 ELISA Kit
MBS764139-04 10x 96 Well

Human Multimerin 1 ELISA Kit

Sign In for Pricing
View Details
TULP1 Recombinant Protein (Mouse)
RP182303 100 µg

TULP1 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
CLEC11A Rabbit Polyclonal Antibody (FITC)
orb2122755 100 µL

CLEC11A Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details