Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CSF2RA protein

This Human CSF2RA protein spans the amino acid sequence from region 23-320aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Granulocyte-Macrophage Colony-Stimulating Factor Receptor Subunit Alpha; GM-CSF-R-Alpha; GMCSFR-Alpha; GMR-Alpha; CDw116; CD116; CSF2RA; CSF2R; CSF2RY

UniProt

P15509

Expression Region

23-320aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined by its ability to inhibit GM-CSF-dependent proliferation of TF‐1 human erythroleukemic cells is 0.5-2 μg/ml.

Form

Lyophilized powder

Molecular Weight

35.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

AA Sequence

EKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Synechococcus sp. Cytochrome b559 subunit alpha (psbE)
MBS1044088 Inquire

Recombinant Synechococcus sp. Cytochrome b559 subunit alpha (psbE)

Sign In for Pricing
View Details
Anti-C6orf52 Antibody
CTA4737-01 30 µL

Anti-C6orf52 Antibody

Sign In for Pricing
View Details
Anti-C6orf52 Antibody
CTA4737-02 50 μL

Anti-C6orf52 Antibody

Sign In for Pricing
View Details
Anti-C6orf52 Antibody
CTA4737-03 100 µL

Anti-C6orf52 Antibody

Sign In for Pricing
View Details
Anti-C6orf52 Antibody
CTA4737-04 200 µL

Anti-C6orf52 Antibody

Sign In for Pricing
View Details
Recombinant Human CKMB Antigen
SMAG3251 1 mg

Recombinant Human CKMB Antigen

Sign In for Pricing
View Details