Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CSF2RA protein

This Human CSF2RA protein spans the amino acid sequence from region 23-320aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Granulocyte-Macrophage Colony-Stimulating Factor Receptor Subunit Alpha; GM-CSF-R-Alpha; GMCSFR-Alpha; GMR-Alpha; CDw116; CD116; CSF2RA; CSF2R; CSF2RY

UniProt

P15509

Expression Region

23-320aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined by its ability to inhibit GM-CSF-dependent proliferation of TF‐1 human erythroleukemic cells is 0.5-2 μg/ml.

Form

Lyophilized powder

Molecular Weight

35.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

AA Sequence

EKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Phosphorylation Adenosine Monophosphate Activated Protein Kinase (p-AMPK) ELISA Kit
orb2810119-01 48 Tests

Mouse Phosphorylation Adenosine Monophosphate Activated Protein Kinase (p-AMPK) ELISA Kit

Sign In for Pricing
View Details
Mouse Phosphorylation Adenosine Monophosphate Activated Protein Kinase (p-AMPK) ELISA Kit
orb2810119-02 96 Tests

Mouse Phosphorylation Adenosine Monophosphate Activated Protein Kinase (p-AMPK) ELISA Kit

Sign In for Pricing
View Details
Mouse Phosphorylation Adenosine Monophosphate Activated Protein Kinase (p-AMPK) ELISA Kit
orb2810119-03 5 x 96 T

Mouse Phosphorylation Adenosine Monophosphate Activated Protein Kinase (p-AMPK) ELISA Kit

Sign In for Pricing
View Details
NPI-2358 (Plinabulin) 25mg
A10654-25 25 mg

NPI-2358 (Plinabulin) 25mg

Sign In for Pricing
View Details
PKR (phospho Thr451) Polyclonal Antibody
E44H00534 100 µL

PKR (phospho Thr451) Polyclonal Antibody

Sign In for Pricing
View Details
ZMAT5 (NM_019103) Human Tagged ORF Clone
RG202215 10 µg

ZMAT5 (NM_019103) Human Tagged ORF Clone

Sign In for Pricing
View Details