Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CSF2RA protein

This Human CSF2RA protein spans the amino acid sequence from region 23-320aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Granulocyte-Macrophage Colony-Stimulating Factor Receptor Subunit Alpha; GM-CSF-R-Alpha; GMCSFR-Alpha; GMR-Alpha; CDw116; CD116; CSF2RA; CSF2R; CSF2RY

UniProt

P15509

Expression Region

23-320aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined by its ability to inhibit GM-CSF-dependent proliferation of TF‐1 human erythroleukemic cells is 0.5-2 μg/ml.

Form

Lyophilized powder

Molecular Weight

35.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

AA Sequence

EKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-6-MAM Monoclonal Antibody (Detection)
PA312 1 mg

Anti-6-MAM Monoclonal Antibody (Detection)

Sign In for Pricing
View Details
BEC . ammonium salt
ALX-270-345-M005 5 mg

BEC . ammonium salt

Sign In for Pricing
View Details
Rabbit Anti-Human Alpha Fodrin mAb
MA776-01 50 μL

Rabbit Anti-Human Alpha Fodrin mAb

Sign In for Pricing
View Details
Rabbit Anti-Human Alpha Fodrin mAb
MA776-02 100 μL

Rabbit Anti-Human Alpha Fodrin mAb

Sign In for Pricing
View Details
Myotilin Rabbit pAb
E2825919 100 µL

Myotilin Rabbit pAb

Sign In for Pricing
View Details
Chicken WD repeat, SAM and U box domain containing protein 1 (WDSUB1) ELISA kit
GTR10393268 96 Well

Chicken WD repeat, SAM and U box domain containing protein 1 (WDSUB1) ELISA kit

Sign In for Pricing
View Details