Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BPHL protein

This Human BPHL protein spans the amino acid sequence from region 38-291aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Biphenyl hydrolase-like protein (Biphenyl hydrolase-related protein) (Bph-rp) (Breast epithelial mucin-associated antigen) (MCNAA)

UniProt

Q86WA6

Expression Region

38-291aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DLD Antibody
orb1260495 100 µL

DLD Antibody

Sign In for Pricing
View Details
TFRC Mouse Monoclonal Antibody (APC-Cy5.5)
orb2363455 100 µL

TFRC Mouse Monoclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
2- (Oxolan-2-yl) -1,3-thiazole-4-carboxylic acid
YGC03112-01 50 mg

2- (Oxolan-2-yl) -1,3-thiazole-4-carboxylic acid

Sign In for Pricing
View Details
2- (Oxolan-2-yl) -1,3-thiazole-4-carboxylic acid
YGC03112-02 0.5 g

2- (Oxolan-2-yl) -1,3-thiazole-4-carboxylic acid

Sign In for Pricing
View Details
Brilliant Violet 421™ anti-human CD137L (4-1BB Ligand)
GT09129 25 Tests

Brilliant Violet 421™ anti-human CD137L (4-1BB Ligand)

Sign In for Pricing
View Details
MIER3, ID (MIER3, Mesoderm induction early response protein 3) (MaxLight 490)
MBS6320817-01 0.1 mL

MIER3, ID (MIER3, Mesoderm induction early response protein 3) (MaxLight 490)

Sign In for Pricing
View Details