Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BPHL protein

This Human BPHL protein spans the amino acid sequence from region 38-291aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Biphenyl hydrolase-like protein (Biphenyl hydrolase-related protein) (Bph-rp) (Breast epithelial mucin-associated antigen) (MCNAA)

UniProt

Q86WA6

Expression Region

38-291aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neutral Red 0.33%
30629526-4 6x100 mL

Neutral Red 0.33%

Sign In for Pricing
View Details
MEF2C (S387) (Myocyte-specific Enhancer Factor 2C) (MaxLight 750)
MBS6488980-01 0.1 mL

MEF2C (S387) (Myocyte-specific Enhancer Factor 2C) (MaxLight 750)

Sign In for Pricing
View Details
MEF2C (S387) (Myocyte-specific Enhancer Factor 2C) (MaxLight 750)
MBS6488980-02 5x 0.1 mL

MEF2C (S387) (Myocyte-specific Enhancer Factor 2C) (MaxLight 750)

Sign In for Pricing
View Details
ZNF346 Polyclonal Antibody, Cy7 Conjugated
bs-12235R-Cy7 100 µL

ZNF346 Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
Efnb3 ORF Vector (Mouse) (pORF)
ORF043676 1.0 µg DNA

Efnb3 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Phospho-BLNK (Tyr96) Rabbit Polyclonal Antibody (HRP)
orb503470 100 µL

Phospho-BLNK (Tyr96) Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details