Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BPHL protein

This Human BPHL protein spans the amino acid sequence from region 38-291aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Biphenyl hydrolase-like protein (Biphenyl hydrolase-related protein) (Bph-rp) (Breast epithelial mucin-associated antigen) (MCNAA)

UniProt

Q86WA6

Expression Region

38-291aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RANBP6 (NM_012416) Human Recombinant Protein
E45H37225M5 20 µg

RANBP6 (NM_012416) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Anabaena variabilis Photosystem I reaction center subunit VIII (psaI), partial
MBS1006699-01 1 mg (E-Coli)

Recombinant Anabaena variabilis Photosystem I reaction center subunit VIII (psaI), partial

Sign In for Pricing
View Details
Recombinant Anabaena variabilis Photosystem I reaction center subunit VIII (psaI), partial
MBS1006699-02 1 mg (Yeast)

Recombinant Anabaena variabilis Photosystem I reaction center subunit VIII (psaI), partial

Sign In for Pricing
View Details
Recombinant HAdV-2 L4 Protein (aa 1-228)
VAng-Cr4261-50gEcoli 50 µg (E. coli)

Recombinant HAdV-2 L4 Protein (aa 1-228)

Sign In for Pricing
View Details
NDE1, NT (Nuclear Distribution Protein nudE Homolog 1, NUDE1, NUDE, FLJ20101, HOM-TES-87) (AP)
MBS6489528-01 0.2 mL

NDE1, NT (Nuclear Distribution Protein nudE Homolog 1, NUDE1, NUDE, FLJ20101, HOM-TES-87) (AP)

Sign In for Pricing
View Details
NDE1, NT (Nuclear Distribution Protein nudE Homolog 1, NUDE1, NUDE, FLJ20101, HOM-TES-87) (AP)
MBS6489528-02 5x 0.2 mL

NDE1, NT (Nuclear Distribution Protein nudE Homolog 1, NUDE1, NUDE, FLJ20101, HOM-TES-87) (AP)

Sign In for Pricing
View Details