Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BPHL protein

This Human BPHL protein spans the amino acid sequence from region 38-291aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Biphenyl hydrolase-like protein (Biphenyl hydrolase-related protein) (Bph-rp) (Breast epithelial mucin-associated antigen) (MCNAA)

UniProt

Q86WA6

Expression Region

38-291aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPRR2A (Biotin)
577721-01 50 µg

SPRR2A (Biotin)

Sign In for Pricing
View Details
SPRR2A (Biotin)
577721-02 100 µg

SPRR2A (Biotin)

Sign In for Pricing
View Details
Lentiviral mouse Vmn1r40 shRNA (UAS) - Lentiviral mouse Vmn1r40 shRNA (UAS, iRFP) (100)
GTR15137499 1 Vial

Lentiviral mouse Vmn1r40 shRNA (UAS) - Lentiviral mouse Vmn1r40 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Mouse Anti-Human CD10 mAb (PE/TR) [HI10a]
E2782895 100 Tests

Mouse Anti-Human CD10 mAb (PE/TR) [HI10a]

Sign In for Pricing
View Details
KLC4 (B-8) Alexa Fluor® 488
sc-376702 AF488 200 µg/mL

KLC4 (B-8) Alexa Fluor® 488

Sign In for Pricing
View Details
NMI (N-myc-interactor, Nmi, N-myc and STAT Interactor) (APC)
130436-APC 100 µL

NMI (N-myc-interactor, Nmi, N-myc and STAT Interactor) (APC)

Sign In for Pricing
View Details