Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria CLOST_2292 protein

This Bacteria CLOST_2292 protein spans the amino acid sequence from region 2-56aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CLOST_2292Ferredoxin

UniProt

P80168

Expression Region

2-56aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Acetoanaerobium sticklandii (strain ATCC 12662 / DSM 519 / JCM 1433 / NCIMB 10654) (Clostridium sticklandii)

Field of Research

Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AYVINDSCISCGACEPECPVNAITAGDDKYVIDAATCIDCGACAGVCPVDAPQPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Dcp2 qPCR Primer Pair
QM39030S 200 Tests

Mouse Dcp2 qPCR Primer Pair

Sign In for Pricing
View Details
Alpha Tubulin Rabbit mAb
58503 50 µL

Alpha Tubulin Rabbit mAb

Sign In for Pricing
View Details
CaM Kinase II Subunit Beta Recombinant Protein
orb1228830 0.05 mg

CaM Kinase II Subunit Beta Recombinant Protein

Sign In for Pricing
View Details
MAGB2 Rabbit Polyclonal Antibody
MBS9515385-01 0.05 mL

MAGB2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MAGB2 Rabbit Polyclonal Antibody
MBS9515385-02 0.1 mL

MAGB2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MAGB2 Rabbit Polyclonal Antibody
MBS9515385-03 5x 0.1 mL

MAGB2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details