Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria sboA protein

This Bacteria sboA protein spans the amino acid sequence from region 9-43aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Antilisterial bacteriocin subtilosin (sbo)

UniProt

O07623

Expression Region

9-43aa

Tag

Tag-Free

Source

E.coli

Origin

Bacillus subtilis (strain 168)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

3.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NKGCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Langya Virus Phosphoprotein (P/V/W/C), N-His
VG9C347-01 1 mg

Recombinant Langya Virus Phosphoprotein (P/V/W/C), N-His

Sign In for Pricing
View Details
Recombinant Langya Virus Phosphoprotein (P/V/W/C), N-His
VG9C347-02 100 µg

Recombinant Langya Virus Phosphoprotein (P/V/W/C), N-His

Sign In for Pricing
View Details
Anti-RAD52 Antibody (3H313)
TMAB-12047-01 25 µL

Anti-RAD52 Antibody (3H313)

Sign In for Pricing
View Details
Anti-RAD52 Antibody (3H313)
TMAB-12047-02 50 μL

Anti-RAD52 Antibody (3H313)

Sign In for Pricing
View Details
Anti-RAD52 Antibody (3H313)
TMAB-12047-03 100 µL

Anti-RAD52 Antibody (3H313)

Sign In for Pricing
View Details
Human P27/Kip1 ELISA Kit
MBS3801454-01 48 Well

Human P27/Kip1 ELISA Kit

Sign In for Pricing
View Details