Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria sboA protein

This Bacteria sboA protein spans the amino acid sequence from region 9-43aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Antilisterial bacteriocin subtilosin (sbo)

UniProt

O07623

Expression Region

9-43aa

Tag

Tag-Free

Source

E.coli

Origin

Bacillus subtilis (strain 168)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

3.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NKGCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin D1 Rabbit Polyclonal Antibody (Cy5.5)
orb1080876 100 µL

Cyclin D1 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
Mouse Ficolin 3 (FCN3) ELISA Kit
orb2667479-01 48 Tests

Mouse Ficolin 3 (FCN3) ELISA Kit

Sign In for Pricing
View Details
Mouse Ficolin 3 (FCN3) ELISA Kit
orb2667479-02 96 Tests

Mouse Ficolin 3 (FCN3) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human VMA21 shRNA (UAS) - Lentiviral human VMA21 shRNA (UAS) plasmid
GTR15101299 1 Vial

Lentiviral human VMA21 shRNA (UAS) - Lentiviral human VMA21 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Momordicoside K
GDA34884-01 5 mg

Momordicoside K

Sign In for Pricing
View Details
Momordicoside K
GDA34884-02 10 mg

Momordicoside K

Sign In for Pricing
View Details