Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus ftnA protein

This Virus ftnA protein spans the amino acid sequence from region 1-167aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pfr

UniProt

P52093

Expression Region

1-167aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLSKDIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLFDHAAEEYEHAKKLIVFLNENNVPVQLTSISAPEHKFEGLTQIFQKAYEHEQHISESINNIVDHAIKGKDHATFNFLQWYVSEQHEEEVLFKDILDKIELIGNENHGLYLADQYVKGIAKSRKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KNG1, NT (KNG1, BDK, KNG, Kininogen-1, Alpha-2-thiol proteinase inhibitor, Fitzgerald factor, High molecular weight kininogen, Williams-Fitzgerald-Flaujeac factor, Kininogen-1 heavy chain, T-kinin, Ile-Ser-Bradykinin, Bradykinin, Kallidin I, Lysyl-bradykinin, Kallidin II, Kininogen-1 light chain, Low molecular weight growth-promoting factor) (FITC) discontinued
037586-FITC 200 µL

KNG1, NT (KNG1, BDK, KNG, Kininogen-1, Alpha-2-thiol proteinase inhibitor, Fitzgerald factor, High molecular weight kininogen, Williams-Fitzgerald-Flaujeac factor, Kininogen-1 heavy chain, T-kinin, Ile-Ser-Bradykinin, Bradykinin, Kallidin I, Lysyl-bradykinin, Kallidin II, Kininogen-1 light chain, Low molecular weight growth-promoting factor) (FITC) discontinued

Sign In for Pricing
View Details
Rabbit Anti-Human E4BP4 Polyclonal Antibody
PA85960HU-01 50 µg

Rabbit Anti-Human E4BP4 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human E4BP4 Polyclonal Antibody
PA85960HU-02 100 µg

Rabbit Anti-Human E4BP4 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human E4BP4 Polyclonal Antibody
PA85960HU-03 500 µg

Rabbit Anti-Human E4BP4 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human E4BP4 Polyclonal Antibody
PA85960HU-04 1 mg

Rabbit Anti-Human E4BP4 Polyclonal Antibody

Sign In for Pricing
View Details
C2orf60 3'UTR Luciferase Stable Cell Line
TU002201 1.0 mL

C2orf60 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details