Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SLURP2 protein

This Human SLURP2 protein spans the amino acid sequence from region 23-97. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Secreted LY6/PLAUR domain-containing protein 2 Secreted Ly-6/uPAR-related protein 2

UniProt

P0DP58

Expression Region

57-131aa of P0DP58-2

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

10 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

IWCHQCTGFGGCSHGSRCLRDSTHCVTTATRVLSNTEDLPLVTKMCHIGCPDIPSLGLGPYVSIACCQTSLCNHD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ces2 Rat Pre-designed siRNA Set A
HY-RS24502 1 Set

Ces2 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
Human ABCA1 (ATP-binding cassette sub-family A member 1) QuickTest ELISA Kit
MBS7619000-01 48 Well

Human ABCA1 (ATP-binding cassette sub-family A member 1) QuickTest ELISA Kit

Sign In for Pricing
View Details
Human ABCA1 (ATP-binding cassette sub-family A member 1) QuickTest ELISA Kit
MBS7619000-02 96 Well

Human ABCA1 (ATP-binding cassette sub-family A member 1) QuickTest ELISA Kit

Sign In for Pricing
View Details
Human ABCA1 (ATP-binding cassette sub-family A member 1) QuickTest ELISA Kit
MBS7619000-03 5x 96 Well

Human ABCA1 (ATP-binding cassette sub-family A member 1) QuickTest ELISA Kit

Sign In for Pricing
View Details
Human ABCA1 (ATP-binding cassette sub-family A member 1) QuickTest ELISA Kit
MBS7619000-04 10x 96 Well

Human ABCA1 (ATP-binding cassette sub-family A member 1) QuickTest ELISA Kit

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Adiponectin (ADP)
MBS2044896-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Adiponectin (ADP)

Sign In for Pricing
View Details