Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LST1 protein

This Human LST1 protein spans the amino acid sequence from region 1-66aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein B144

UniProt

O00453

Expression Region

1-66aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Isoform 10

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLSRNDVKRLERSWAQGSSEQELHYASLQRLPVPSSEGPDLRGRDKRGTKEDPRADYACIAENKPT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, HMW (KRTH/1076), 1mg/mL
BNUM1076-50 1x 50 µL

Cytokeratin, HMW (KRTH/1076), 1mg/mL

Sign In for Pricing
View Details
Rabbit Anti RPLP0 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,IHC,ELISA) 200ul
IRBAMLRPLP0AP583200UL 200 µL

Rabbit Anti RPLP0 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,IHC,ELISA) 200ul

Sign In for Pricing
View Details
Fish Putative Uncharacterized Protein C10orf99 (C10ORF99) ELISA Kit
MBS9352827 Inquire

Fish Putative Uncharacterized Protein C10orf99 (C10ORF99) ELISA Kit

Sign In for Pricing
View Details
Human Gp91 phox beta 1
117212 100 µg

Human Gp91 phox beta 1

Sign In for Pricing
View Details
Recombinant rabbit IL-17A protein
OPCA01256-20UG 20 µg

Recombinant rabbit IL-17A protein

Sign In for Pricing
View Details
RASD2 (5K15) Mouse Monoclonal antibody
E28PE3539 100 µL

RASD2 (5K15) Mouse Monoclonal antibody

Sign In for Pricing
View Details