Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LST1 protein

This Human LST1 protein spans the amino acid sequence from region 1-66aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein B144

UniProt

O00453

Expression Region

1-66aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Isoform 10

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLSRNDVKRLERSWAQGSSEQELHYASLQRLPVPSSEGPDLRGRDKRGTKEDPRADYACIAENKPT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal PBXIP1 Antibody [Allophycocyanin]
NBP3-05982APC 0.1 mL

Rabbit Polyclonal PBXIP1 Antibody [Allophycocyanin]

Sign In for Pricing
View Details
GENLISA Rat Platelet/Endothelial Cell Adhesion Molecule (PECAM1) ELISA
KLR3377 1x 96 Well

GENLISA Rat Platelet/Endothelial Cell Adhesion Molecule (PECAM1) ELISA

Sign In for Pricing
View Details
SPAK Polyclonal Antibody
MBS8525359-01 0.1 mg

SPAK Polyclonal Antibody

Sign In for Pricing
View Details
SPAK Polyclonal Antibody
MBS8525359-02 0.1 mL (AF635)

SPAK Polyclonal Antibody

Sign In for Pricing
View Details
SPAK Polyclonal Antibody
MBS8525359-03 0.1 mL (AF610)

SPAK Polyclonal Antibody

Sign In for Pricing
View Details
SPAK Polyclonal Antibody
MBS8525359-04 0.1 mL (AF405S)

SPAK Polyclonal Antibody

Sign In for Pricing
View Details