Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human COL17A1 protein

This Human COL17A1 protein spans the amino acid sequence from region 1253-1497aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

180KDA bullous pemphigoid antigen 2Bullous pemphigoid antigen 2

UniProt

Q9UMD9

Expression Region

1253-1497aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YLTSPDVRSFIVGPPGPPGPQGPPGDSRLLSTDASHSRGSSSSSHSSSVRRGSSYSSSMSTGGGGAGSLGAGGAFGEAAGDRGPYGTDIGPGGGYGAAAEGGMYAGNGGLLGADFAGDLDYNELAVRVSESMQRQGLLQGMAYTVQGPPGQPGPQGPPGISKVFSAYSNVTADLMDFFQTYGAIQGPPGQKGEMGTPGPKGDRGPAGPPGHPGPPGPRGHKGEKGDKGDQVYAGRRRRRSIAVKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRP Antibody
GWB-T00618 1 mg

CRP Antibody

Sign In for Pricing
View Details
Human ZNF280B knockdown cell line
ABC-KD17455 1 Vial

Human ZNF280B knockdown cell line

Sign In for Pricing
View Details
PPP1R3B AAV Vector (Human) (CMV)
37454101 1 µg

PPP1R3B AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
N,5-Dimethyl-1,3-thiazol-2-amine hydrochloride
TPD50793-01 250 mg

N,5-Dimethyl-1,3-thiazol-2-amine hydrochloride

Sign In for Pricing
View Details
N,5-Dimethyl-1,3-thiazol-2-amine hydrochloride
TPD50793-02 2.5 g

N,5-Dimethyl-1,3-thiazol-2-amine hydrochloride

Sign In for Pricing
View Details
Buserelin Acetate
562478 1.0mg

Buserelin Acetate

Sign In for Pricing
View Details