Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human COL17A1 protein

This Human COL17A1 protein spans the amino acid sequence from region 1253-1497aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

180KDA bullous pemphigoid antigen 2Bullous pemphigoid antigen 2

UniProt

Q9UMD9

Expression Region

1253-1497aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YLTSPDVRSFIVGPPGPPGPQGPPGDSRLLSTDASHSRGSSSSSHSSSVRRGSSYSSSMSTGGGGAGSLGAGGAFGEAAGDRGPYGTDIGPGGGYGAAAEGGMYAGNGGLLGADFAGDLDYNELAVRVSESMQRQGLLQGMAYTVQGPPGQPGPQGPPGISKVFSAYSNVTADLMDFFQTYGAIQGPPGQKGEMGTPGPKGDRGPAGPPGHPGPPGPRGHKGEKGDKGDQVYAGRRRRRSIAVKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SERPINC1 Polyclonal Antibody, Cy5 Conjugated
bs-1636R-Cy5 100 µL

SERPINC1 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
FITC Linked Polyclonal Antibody to Aquaporin 1 (AQP1)
MBS2130296-01 0.1 mL

FITC Linked Polyclonal Antibody to Aquaporin 1 (AQP1)

Sign In for Pricing
View Details
FITC Linked Polyclonal Antibody to Aquaporin 1 (AQP1)
MBS2130296-02 0.2 mL

FITC Linked Polyclonal Antibody to Aquaporin 1 (AQP1)

Sign In for Pricing
View Details
FITC Linked Polyclonal Antibody to Aquaporin 1 (AQP1)
MBS2130296-03 0.5 mL

FITC Linked Polyclonal Antibody to Aquaporin 1 (AQP1)

Sign In for Pricing
View Details
FITC Linked Polyclonal Antibody to Aquaporin 1 (AQP1)
MBS2130296-04 1 mL

FITC Linked Polyclonal Antibody to Aquaporin 1 (AQP1)

Sign In for Pricing
View Details
FITC Linked Polyclonal Antibody to Aquaporin 1 (AQP1)
MBS2130296-05 5 mL

FITC Linked Polyclonal Antibody to Aquaporin 1 (AQP1)

Sign In for Pricing
View Details