Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DNRA protein

This Human DNRA protein spans the amino acid sequence from region 21-80aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Endothelin A receptor , ET-A , ETA-R , hET-AR

UniProt

P25101

Expression Region

21-80aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

8.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 21-80aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(2R) -2-[ (5-Bromopyridin-2-yl) amino]butan-1-ol
HXC93943-01 50 mg

(2R) -2-[ (5-Bromopyridin-2-yl) amino]butan-1-ol

Sign In for Pricing
View Details
(2R) -2-[ (5-Bromopyridin-2-yl) amino]butan-1-ol
HXC93943-02 0.5 g

(2R) -2-[ (5-Bromopyridin-2-yl) amino]butan-1-ol

Sign In for Pricing
View Details
BAF Lentiviral Activation Particles (h)
sc-401654-LAC 200 µL

BAF Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
4-Fluorobenzyl bromide
277320-01 50 g

4-Fluorobenzyl bromide

Sign In for Pricing
View Details
4-Fluorobenzyl bromide
277320-02 100 g

4-Fluorobenzyl bromide

Sign In for Pricing
View Details
4-Fluorobenzyl bromide
277320-03 250 g

4-Fluorobenzyl bromide

Sign In for Pricing
View Details