Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Viral UL131 protein

This Viral UL131 protein spans the amino acid sequence from region 1-76aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

UL131Uncharacterized protein UL131

UniProt

P16773

Expression Region

1-76aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

In vitro E.coli expression system

Origin

Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-SUMO-tagged: N-terminal 6xHis-SUMO-tagged55-338AA: 1-76AAExtracellular Domain: Full length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MCMMSHNKAFFLSLQHAAVSGVAVCLSVRRGAGSVPAGNRGKKTIITEYRITGTRALARCPTKPVTSMWNSSWTSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Phosphofructokinase, Platelet (PFKP) ELISA Kit
RD-PFKP-Hu-48Tests 48 Tests

Human Phosphofructokinase, Platelet (PFKP) ELISA Kit

Sign In for Pricing
View Details
Mouse Adipose Vascular Stromal Cells
AFG-ELL-2105 > 5x 10^5 Cells / Vial

Mouse Adipose Vascular Stromal Cells

Sign In for Pricing
View Details
Mouse Monoclonal DEF6 Antibody (OTI3F9) [Alexa Fluor 488]
NBP2-71868AF488 0.1 mL

Mouse Monoclonal DEF6 Antibody (OTI3F9) [Alexa Fluor 488]

Sign In for Pricing
View Details
pEG302 22aa SunTag NtDRMcd (no NLS) g4+g10+g18 (FWA) Plasmid
PVT20400 2 µg

pEG302 22aa SunTag NtDRMcd (no NLS) g4+g10+g18 (FWA) Plasmid

Sign In for Pricing
View Details
CFAP298 shRNA (m) Lentiviral Particles
sc-108141-V 200 µL

CFAP298 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Chicken B Cell Leukemia X Long ELISA Kit
MBS032732 Inquire

Chicken B Cell Leukemia X Long ELISA Kit

Sign In for Pricing
View Details