Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Viral UL131 protein

This Viral UL131 protein spans the amino acid sequence from region 1-76aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

UL131Uncharacterized protein UL131

UniProt

P16773

Expression Region

1-76aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

In vitro E.coli expression system

Origin

Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-SUMO-tagged: N-terminal 6xHis-SUMO-tagged55-338AA: 1-76AAExtracellular Domain: Full length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MCMMSHNKAFFLSLQHAAVSGVAVCLSVRRGAGSVPAGNRGKKTIITEYRITGTRALARCPTKPVTSMWNSSWTSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FcgR3A (Fc Fragment Of IgG Low Affinity IIIa Receptor) ELISA Kit
MBS8802839-01 48 Well

Human FcgR3A (Fc Fragment Of IgG Low Affinity IIIa Receptor) ELISA Kit

Sign In for Pricing
View Details
Human FcgR3A (Fc Fragment Of IgG Low Affinity IIIa Receptor) ELISA Kit
MBS8802839-02 96 Well

Human FcgR3A (Fc Fragment Of IgG Low Affinity IIIa Receptor) ELISA Kit

Sign In for Pricing
View Details
Human FcgR3A (Fc Fragment Of IgG Low Affinity IIIa Receptor) ELISA Kit
MBS8802839-03 5x 96 Well

Human FcgR3A (Fc Fragment Of IgG Low Affinity IIIa Receptor) ELISA Kit

Sign In for Pricing
View Details
Human FcgR3A (Fc Fragment Of IgG Low Affinity IIIa Receptor) ELISA Kit
MBS8802839-04 10x 96 Well

Human FcgR3A (Fc Fragment Of IgG Low Affinity IIIa Receptor) ELISA Kit

Sign In for Pricing
View Details
N-Desmethyl Loperamide-d3
008597 1 mg

N-Desmethyl Loperamide-d3

Sign In for Pricing
View Details
Cavy E3 Ubiquitin-Protein Ligase HERC2 (HERC2) ELISA Kit
MBS9909898 Inquire

Cavy E3 Ubiquitin-Protein Ligase HERC2 (HERC2) ELISA Kit

Sign In for Pricing
View Details