Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MEMO1 protein

This Human MEMO1 protein spans the amino acid sequence from region 1-297aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C21orf19-like protein Hepatitis C virus NS5A-transactivated protein 7

UniProt

Q9Y316

Expression Region

1-297aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

60.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-296AA: 1-297AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSNRVVCREASHAGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAAHAYKQVDPSITRRIFILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGMFERMSLQTDEDEHSIEMHLPYTAKAMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFCHWGQRFRYSYYDESQGEIYRSIEHLDKMGMSIIEQLDPVSFSNYLKKYHNTICGRHPIGVLLNAITELQKNGMNMSFSFLNYAQSSQCRNWQDSSVSYAAGALTVH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

(R) -1-Cyclohexyl-2,2,2-trifluoroethan-1-amine
PC1003036-01 100 mg

(R) -1-Cyclohexyl-2,2,2-trifluoroethan-1-amine

Sign In for Pricing
View Details
(R) -1-Cyclohexyl-2,2,2-trifluoroethan-1-amine
PC1003036-02 250 mg

(R) -1-Cyclohexyl-2,2,2-trifluoroethan-1-amine

Sign In for Pricing
View Details
(R) -1-Cyclohexyl-2,2,2-trifluoroethan-1-amine
PC1003036-03 1 g

(R) -1-Cyclohexyl-2,2,2-trifluoroethan-1-amine

Sign In for Pricing
View Details
80nm Reactant Free Silver Nanoparticles
SRF-80-20 20 mL

80nm Reactant Free Silver Nanoparticles

Sign In for Pricing
View Details
Goat Coronin 6 (CORO6) ELISA Kit
GTR10357997 96 Well

Goat Coronin 6 (CORO6) ELISA Kit

Sign In for Pricing
View Details
Pla2g2c Mouse qPCR Primer Pair (NM_008868)
MP210938 200 Reactions

Pla2g2c Mouse qPCR Primer Pair (NM_008868)

Sign In for Pricing
View Details