Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MEMO1 protein

This Human MEMO1 protein spans the amino acid sequence from region 1-297aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C21orf19-like protein Hepatitis C virus NS5A-transactivated protein 7

UniProt

Q9Y316

Expression Region

1-297aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

60.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-296AA: 1-297AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSNRVVCREASHAGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAAHAYKQVDPSITRRIFILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGMFERMSLQTDEDEHSIEMHLPYTAKAMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFCHWGQRFRYSYYDESQGEIYRSIEHLDKMGMSIIEQLDPVSFSNYLKKYHNTICGRHPIGVLLNAITELQKNGMNMSFSFLNYAQSSQCRNWQDSSVSYAAGALTVH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RFT1 3'UTR Luciferase Stable Cell Line
TU019798 1.0 mL

RFT1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
SNORD54 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2230006 1.0 µg DNA

SNORD54 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Anti-SCRN1 Mouse Monoclonal Antibody [Clone ID: OTI1F2]
M10002 100 µL

Anti-SCRN1 Mouse Monoclonal Antibody [Clone ID: OTI1F2]

Sign In for Pricing
View Details
Pigeon PolioVirus Receptor ELISA Kit
MBS098241 Inquire

Pigeon PolioVirus Receptor ELISA Kit

Sign In for Pricing
View Details
REEP4 (NM_025232) Human Untagged Clone
SC322422 10 µg

REEP4 (NM_025232) Human Untagged Clone

Sign In for Pricing
View Details
Human Serine/threonine-protein kinase RIO1 (RIOK1) ELISA Kit
KTE60795-01 48 Tests

Human Serine/threonine-protein kinase RIO1 (RIOK1) ELISA Kit

Sign In for Pricing
View Details