Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial bamA protein

This Bacterial bamA protein spans the amino acid sequence from region 24-172aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BamA, yaeT, KPK_4543Outer membrane protein assembly factor BamA

UniProt

B5Y1J4

Expression Region

24-172aa

Tag

N-terminal 10XHis-B2M-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Klebsiella pneumoniae (strain 342)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-B2M-tagged: N-terminal 10xHis-B2M-tagged and C-terminal myc-tag51-326AA: 24-172AAFull Length : Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FVVKDIHFEGLQRVAVGAALLSMPVRPGDTVTDDDISNTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVRVGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DMWD Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-13042R-BF405 100 µL

DMWD Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Zfp459 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
50987114 3x 1.0 µg

Zfp459 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
10nm Endotoxin Free Silver Nanoparticles
SEF-10-1000 1000 mL

10nm Endotoxin Free Silver Nanoparticles

Sign In for Pricing
View Details
Tubg2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3800106 1.0 µg DNA

Tubg2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Rabbit Monoclonal Serpin B6 Antibody (202)
NBP3-05916-100ul 100 µL

Rabbit Monoclonal Serpin B6 Antibody (202)

Sign In for Pricing
View Details
Lentiviral human GALNTL5 sgRNA gene knockout kit - Lentiviral human GALNTL5 sgRNA gene knockout kit (25)
GTR15391728 1 Vial

Lentiviral human GALNTL5 sgRNA gene knockout kit - Lentiviral human GALNTL5 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details