Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial bamA protein

This Bacterial bamA protein spans the amino acid sequence from region 24-172aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BamA, yaeT, KPK_4543Outer membrane protein assembly factor BamA

UniProt

B5Y1J4

Expression Region

24-172aa

Tag

N-terminal 10XHis-B2M-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Klebsiella pneumoniae (strain 342)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-B2M-tagged: N-terminal 10xHis-B2M-tagged and C-terminal myc-tag51-326AA: 24-172AAFull Length : Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FVVKDIHFEGLQRVAVGAALLSMPVRPGDTVTDDDISNTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVRVGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GART Rabbit pAb
A3876-01 100 μL

GART Rabbit pAb

Sign In for Pricing
View Details
GART Rabbit pAb
A3876-02 20 µL

GART Rabbit pAb

Sign In for Pricing
View Details
GART Rabbit pAb
A3876-03 500 μL

GART Rabbit pAb

Sign In for Pricing
View Details
GART Rabbit pAb
A3876-04 1000 μL

GART Rabbit pAb

Sign In for Pricing
View Details
CDKN1A (HGNC:1784) Antibody
orb3159735-01 50 µL

CDKN1A (HGNC:1784) Antibody

Sign In for Pricing
View Details
CDKN1A (HGNC:1784) Antibody
orb3159735-02 100 µL

CDKN1A (HGNC:1784) Antibody

Sign In for Pricing
View Details