Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Radish AFP2 protein

This Radish AFP2 protein spans the amino acid sequence from region 30-80aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cysteine-rich antifungal protein 2 Short name, AFP2 Short name, RAFP2

UniProt

P30230

Expression Region

30-80aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Raphanus sativus (Radish)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Plin3, CT (Plin3, M6prbp1, Tip47, Perilipin-3, Cargo selection protein TIP47, Mannose-6-phosphate receptor-binding protein 1) (PE)
MBS6334959-01 0.2 mL

Plin3, CT (Plin3, M6prbp1, Tip47, Perilipin-3, Cargo selection protein TIP47, Mannose-6-phosphate receptor-binding protein 1) (PE)

Sign In for Pricing
View Details
Plin3, CT (Plin3, M6prbp1, Tip47, Perilipin-3, Cargo selection protein TIP47, Mannose-6-phosphate receptor-binding protein 1) (PE)
MBS6334959-02 5x 0.2 mL

Plin3, CT (Plin3, M6prbp1, Tip47, Perilipin-3, Cargo selection protein TIP47, Mannose-6-phosphate receptor-binding protein 1) (PE)

Sign In for Pricing
View Details
Rat Toll Like Receptor 8 ELISA kit
GTR10431898 96 Well

Rat Toll Like Receptor 8 ELISA kit

Sign In for Pricing
View Details
SLC37A2 Antibody, FITC conjugated
CSB-PA819478LC01HU-01 50 µg

SLC37A2 Antibody, FITC conjugated

Sign In for Pricing
View Details
SLC37A2 Antibody, FITC conjugated
CSB-PA819478LC01HU-02 100 µg

SLC37A2 Antibody, FITC conjugated

Sign In for Pricing
View Details
Mmu-miR-143-5p miRNA Inhibitor
orb1870063-01 10 nmol

Mmu-miR-143-5p miRNA Inhibitor

Sign In for Pricing
View Details