Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Radish AFP2 protein

This Radish AFP2 protein spans the amino acid sequence from region 30-80aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cysteine-rich antifungal protein 2 Short name, AFP2 Short name, RAFP2

UniProt

P30230

Expression Region

30-80aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Raphanus sativus (Radish)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C15ORF26 antibody
70R-4410 50 ug

C15ORF26 antibody

Sign In for Pricing
View Details
Recombinant Human NCSTN Protein, N-His
bs-102315P-01 20 µg

Recombinant Human NCSTN Protein, N-His

Sign In for Pricing
View Details
Recombinant Human NCSTN Protein, N-His
bs-102315P-02 50 µg

Recombinant Human NCSTN Protein, N-His

Sign In for Pricing
View Details
PPAT 3'UTR Lenti-reporter-Luc Vector
37301081 1.0 µg

PPAT 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Ethyl 8-aminoquinoline-3-carboxylate
OR86340-01 100 mg

Ethyl 8-aminoquinoline-3-carboxylate

Sign In for Pricing
View Details
Ethyl 8-aminoquinoline-3-carboxylate
OR86340-02 1 g

Ethyl 8-aminoquinoline-3-carboxylate

Sign In for Pricing
View Details