Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GLI2 protein

This Human GLI2 protein spans the amino acid sequence from region 412-641aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GLI family zinc finger protein 2 Tax helper protein

UniProt

P10070

Expression Region

412-641aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EQLADLKEDLDRDDCKQEAEVVIYETNCHWEDCTKEYDTQEQLVHHINNEHIHGEKKEFVCRWQACTREQKPFKAQYMLVVHMRRHTGEKPHKCTFEGCSKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEKPYICKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKQRNDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MED26 Antibody
8C10228-AAT 50 µg

MED26 Antibody

Sign In for Pricing
View Details
Isothiocyanatocyclohexane
TRC-I905115-1G 1 g

Isothiocyanatocyclohexane

Sign In for Pricing
View Details
P130 Cas (Ab-165) Antibody
8B0695-AAT 50 µg

P130 Cas (Ab-165) Antibody

Sign In for Pricing
View Details
Recombinant IL-1RA Monoclonal Antibody
AN301912L-01 50 µL

Recombinant IL-1RA Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant IL-1RA Monoclonal Antibody
AN301912L-02 100 µL

Recombinant IL-1RA Monoclonal Antibody

Sign In for Pricing
View Details
Gasdermin like (GSDMB) (NM_001165959) Human Over-expression Lysate
LC431353 20 µg

Gasdermin like (GSDMB) (NM_001165959) Human Over-expression Lysate

Sign In for Pricing
View Details