Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GLI2 protein

This Human GLI2 protein spans the amino acid sequence from region 412-641aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GLI family zinc finger protein 2 Tax helper protein

UniProt

P10070

Expression Region

412-641aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EQLADLKEDLDRDDCKQEAEVVIYETNCHWEDCTKEYDTQEQLVHHINNEHIHGEKKEFVCRWQACTREQKPFKAQYMLVVHMRRHTGEKPHKCTFEGCSKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEKPYICKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKQRNDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elastin (ELN) (NM_001278916) Human Tagged ORF Clone
RG239238 10 µg

Elastin (ELN) (NM_001278916) Human Tagged ORF Clone

Sign In for Pricing
View Details
CD79b (B-Cell Marker) (IGB/1843), 0.2mg/mL
BNUB1843-100 1x 100 µL

CD79b (B-Cell Marker) (IGB/1843), 0.2mg/mL

Sign In for Pricing
View Details
3,3'-Dithiobis[6-nitrobenzoic Acid]
TRC-D479840-50G 50 g

3,3'-Dithiobis[6-nitrobenzoic Acid]

Sign In for Pricing
View Details
Presenilin 2 (PSEN2) Human Gene Knockout Kit (CRISPR)
KN202921BN 1 Kit

Presenilin 2 (PSEN2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Fallopian tube
CS800412 5x 5 µm

Tissue FFPE Sections, Fallopian tube

Sign In for Pricing
View Details
SHE (NM_001010846) Human Over-expression Lysate
LY423180 100 µg

SHE (NM_001010846) Human Over-expression Lysate

Sign In for Pricing
View Details