Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PTHY protein (Active)

This Human PTHY protein (Active) spans the amino acid sequence from region 32-115aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

PTH, Parathyrin

UniProt

P01270

Expression Region

32-115aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by its ability to induce cAMP accumulation in murine MC3T3E1 cells is less than 50 ng/ml, corresponding to a specific activity of > 2.0 x 10 ^ 4 IU/mg.

Form

Lyophilized powder

Molecular Weight

9.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OSBPL9 Antibody
MBS9523810-01 0.04 mL

OSBPL9 Antibody

Sign In for Pricing
View Details
OSBPL9 Antibody
MBS9523810-02 0.1 mL

OSBPL9 Antibody

Sign In for Pricing
View Details
OSBPL9 Antibody
MBS9523810-03 0.2 mL

OSBPL9 Antibody

Sign In for Pricing
View Details
OSBPL9 Antibody
MBS9523810-04 5x 0.2 mL

OSBPL9 Antibody

Sign In for Pricing
View Details
ABC3C Rabbit Polyclonal Antibody
MBS9513207-01 0.05 mL

ABC3C Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ABC3C Rabbit Polyclonal Antibody
MBS9513207-02 0.1 mL

ABC3C Rabbit Polyclonal Antibody

Sign In for Pricing
View Details