Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CYP11B1 protein

This Human CYP11B1 protein spans the amino acid sequence from region 25-503aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CYP11B1, S11BHCytochrome P450 11B1, mitochondrial, CYPXIB1, Cytochrome P-450c11, Cytochrome P450C11, Steroid 11-beta-hydroxylase, CYP11B1, EC 1.14.15.4

UniProt

P15538

Expression Region

25-503aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

74.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQGYEDLHLEVHQTFQELGPIFRYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELSPDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRPERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQEDIKMVYSFILRPSMFPLLTFRAIN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine AP12 ELISA Kit
EPA0843 96 Tests

Porcine AP12 ELISA Kit

Sign In for Pricing
View Details
LRP2 Human Gene Knockout Kit (CRISPR)
KN213707RB 1 Kit

LRP2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Hamster Adrenomedullin ELISA Kit
MBS041181-01 48 Well

Hamster Adrenomedullin ELISA Kit

Sign In for Pricing
View Details
Hamster Adrenomedullin ELISA Kit
MBS041181-02 96 Well

Hamster Adrenomedullin ELISA Kit

Sign In for Pricing
View Details
Hamster Adrenomedullin ELISA Kit
MBS041181-03 5x 96 Well

Hamster Adrenomedullin ELISA Kit

Sign In for Pricing
View Details
Hamster Adrenomedullin ELISA Kit
MBS041181-04 10x 96 Well

Hamster Adrenomedullin ELISA Kit

Sign In for Pricing
View Details