Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse CXL11 protein (Active)

This Mouse CXL11 protein (Active) spans the amino acid sequence from region 22-100aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Interferon-inducible T-cell alpha chemoattractant, Small-inducible cytokine B11

UniProt

Q9JHH5

Expression Region

22-100aa

Tag

Tag-Free

Source

E.Coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 98% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using murine CXCR3 transfected 293 cells is in a concentration of 10-100 ng/ml.

Form

Lyophilized powder

Molecular Weight

9.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

FLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQNM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hematoxiline Solution (1% Aqueous)
40100335-2 500 mL

Hematoxiline Solution (1% Aqueous)

Sign In for Pricing
View Details
Recombinant Shigella sonnei Leucine--tRNA ligase (leuS), partial
MBS1402936 Inquire

Recombinant Shigella sonnei Leucine--tRNA ligase (leuS), partial

Sign In for Pricing
View Details
Integrin alpha 3 (ITGA3) Rabbit Polyclonal Antibody
TA361386 100 µL

Integrin alpha 3 (ITGA3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PAK3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1590107 1.0 µg DNA

PAK3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
XRRA1 (NM_182969) Human Over-expression Lysate
E45H16024-2 20 µg

XRRA1 (NM_182969) Human Over-expression Lysate

Sign In for Pricing
View Details
DCAF4L2 siRNA (Human)
orb1853047-01 15 nmol

DCAF4L2 siRNA (Human)

Sign In for Pricing
View Details