Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse CXL11 protein (Active)

This Mouse CXL11 protein (Active) spans the amino acid sequence from region 22-100aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Interferon-inducible T-cell alpha chemoattractant, Small-inducible cytokine B11

UniProt

Q9JHH5

Expression Region

22-100aa

Tag

Tag-Free

Source

E.Coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 98% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using murine CXCR3 transfected 293 cells is in a concentration of 10-100 ng/ml.

Form

Lyophilized powder

Molecular Weight

9.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

FLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQNM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CENPM
pro-1626 2µg

CENPM

Sign In for Pricing
View Details
RhoBTB1 Blocking Peptide
orb706646-01 1 mg

RhoBTB1 Blocking Peptide

Sign In for Pricing
View Details
RhoBTB1 Blocking Peptide
orb706646-02 5 mg

RhoBTB1 Blocking Peptide

Sign In for Pricing
View Details
RPMI 1640 Medium w/o L-Glutamine, L-Serine, HEPES (Liquid)
R8999-15-L 500 mL

RPMI 1640 Medium w/o L-Glutamine, L-Serine, HEPES (Liquid)

Sign In for Pricing
View Details
Fibulin 5 (FBLN5) Antibody
abx010772 100 µL

Fibulin 5 (FBLN5) Antibody

Sign In for Pricing
View Details
BAG5, Recombinant, Human, aa1-447, His-SUMO-Tag (BAG Family Molecular Chaperone Regulator 5)
372404-01 20 µg

BAG5, Recombinant, Human, aa1-447, His-SUMO-Tag (BAG Family Molecular Chaperone Regulator 5)

Sign In for Pricing
View Details