Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse CXCL9 protein (Active)

This Mouse CXCL9 protein (Active) spans the amino acid sequence from region 22-126. Purity: > 95% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Gamma-interferon-induced monokine, MIG, MuMIG, Protein m119, Small-inducible cytokine B9

UniProt

P18340

Expression Region

22-126

Tag

Tag-Free

Source

E.Coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 95% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human lymphocytes is in a concentration range of 0.1-1.0 ng/ml.

Form

Lyophilized powder

Molecular Weight

12.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

TLVIRNARCSCISTSRGTIHYKSLKDLKQFAPSPNCNKTEIIATLKNGDQTCLDPDSANVKKLMKEWEKKINQKKKQKRGKKHQKNMKNRKPKTPQSRRRSRKTT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLAC4 Human shRNA Plasmid Kit (Locus ID 191585)
TL318986 1 Kit

PLAC4 Human shRNA Plasmid Kit (Locus ID 191585)

Sign In for Pricing
View Details
Recombinant Human IGF2BP1 Protein, N-His
orb2965971-01 50 µg

Recombinant Human IGF2BP1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human IGF2BP1 Protein, N-His
orb2965971-02 100 µg

Recombinant Human IGF2BP1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human IGF2BP1 Protein, N-His
orb2965971-03 1 mg

Recombinant Human IGF2BP1 Protein, N-His

Sign In for Pricing
View Details
RPL18 (60S Ribosomal Protein L18) (APC)
132779-APC 100 µL

RPL18 (60S Ribosomal Protein L18) (APC)

Sign In for Pricing
View Details
Lentiviral human MATN3 shRNA (UAS) - Lentiviral human MATN3 shRNA (UAS) (100)
GTR15092190 1 Vial

Lentiviral human MATN3 shRNA (UAS) - Lentiviral human MATN3 shRNA (UAS) (100)

Sign In for Pricing
View Details