Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse CXCL9 protein (Active)

This Mouse CXCL9 protein (Active) spans the amino acid sequence from region 22-126. Purity: > 95% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Gamma-interferon-induced monokine, MIG, MuMIG, Protein m119, Small-inducible cytokine B9

UniProt

P18340

Expression Region

22-126

Tag

Tag-Free

Source

E.Coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 95% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human lymphocytes is in a concentration range of 0.1-1.0 ng/ml.

Form

Lyophilized powder

Molecular Weight

12.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

TLVIRNARCSCISTSRGTIHYKSLKDLKQFAPSPNCNKTEIIATLKNGDQTCLDPDSANVKKLMKEWEKKINQKKKQKRGKKHQKNMKNRKPKTPQSRRRSRKTT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TMED5/p28 Antibody Picoband®, PE Conjugate
A12319-1-PE 100 µg/Vial

Anti-TMED5/p28 Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details
MRPL11 discontinued
391751 200 µL

MRPL11 discontinued

Sign In for Pricing
View Details
SOD1 Antibody, Biotin conjugated
A39288-50UG 50 µg

SOD1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Proteasome Subunit Beta Type 4 (PSMB4) Antibody Pair
abx117432 5x 96 Tests

Proteasome Subunit Beta Type 4 (PSMB4) Antibody Pair

Sign In for Pricing
View Details
Sheep Collagen Type XI Alpha 1 ELISA kit
GTR10414421 96 Well

Sheep Collagen Type XI Alpha 1 ELISA kit

Sign In for Pricing
View Details
Picraquassioside B
orb2653615-01 50 mg

Picraquassioside B

Sign In for Pricing
View Details