Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse CXCL3 protein (Active)

This Mouse CXCL3 protein (Active) spans the amino acid sequence from region 28-100aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Dendritic cell inflammatory protein 1

UniProt

Q6W5C0

Expression Region

28-100aa

Tag

Tag-Free

Source

E.Coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human CXCR2 transfected human 293 cells is in a concentration range of 10-100 ng/ml.

Form

Lyophilized powder

Molecular Weight

7.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

AVVASELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HAND1 Conjugated Antibody
orb1616608 100 µL

HAND1 Conjugated Antibody

Sign In for Pricing
View Details
Mouse Leptin ELISA Kit
BEK1137 96 Tests

Mouse Leptin ELISA Kit

Sign In for Pricing
View Details
Bovine Transthyretin ELISA Kit (Ready to Use)
orb549315-01 48 Tests

Bovine Transthyretin ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Bovine Transthyretin ELISA Kit (Ready to Use)
orb549315-02 96 Tests

Bovine Transthyretin ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Telotristat (LP778902)
466929 2.5 mg

Telotristat (LP778902)

Sign In for Pricing
View Details
COPS3 Antibody
orb1328782 100 µg

COPS3 Antibody

Sign In for Pricing
View Details