Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse GROA protein (Active)

This Mouse GROA protein (Active) spans the amino acid sequence from region 25-96aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

C-X-C motif chemokine 1, Secretory protein N51, , Hematopoietic synergistic factor, HSF

UniProt

P12850

Expression Region

25-96aa

Tag

Tag-Free

Source

E.Coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood neutrophils is in a concentration range of 10-100 ng/ml.

Form

Lyophilized powder

Molecular Weight

7.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

APIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-IgM Nanobody (SAA1253) (Alpaca, Monoclonal, VHH-8His-Cys-tag)
A129950 100 µL

Anti-IgM Nanobody (SAA1253) (Alpaca, Monoclonal, VHH-8His-Cys-tag)

Sign In for Pricing
View Details
ZO-2, Mid (Tight Junction-associated Polypeptide, Zonula Occludens 2) (MaxLight 405)
MBS6506625-01 0.1 mL

ZO-2, Mid (Tight Junction-associated Polypeptide, Zonula Occludens 2) (MaxLight 405)

Sign In for Pricing
View Details
ZO-2, Mid (Tight Junction-associated Polypeptide, Zonula Occludens 2) (MaxLight 405)
MBS6506625-02 5x 0.1 mL

ZO-2, Mid (Tight Junction-associated Polypeptide, Zonula Occludens 2) (MaxLight 405)

Sign In for Pricing
View Details
PHOS / PDC Antibody (YA7071, Rabbit)
HY-P87388 1 Each

PHOS / PDC Antibody (YA7071, Rabbit)

Sign In for Pricing
View Details
Human IGF-BP2 Recombinant Protein Lyophilized
MBS8432288-01 0.005 mg

Human IGF-BP2 Recombinant Protein Lyophilized

Sign In for Pricing
View Details
Human IGF-BP2 Recombinant Protein Lyophilized
MBS8432288-02 5x 0.005 mg

Human IGF-BP2 Recombinant Protein Lyophilized

Sign In for Pricing
View Details