Mouse GROA protein (Active)
This Mouse GROA protein (Active) spans the amino acid sequence from region 25-96aa. Purity: > 97% as determined by SDS-PAGE and HPLC.
Product Specifications
Product Name Alternative
C-X-C motif chemokine 1, Secretory protein N51, , Hematopoietic synergistic factor, HSF
UniProt
P12850
Expression Region
25-96aa
Tag
Tag-Free
Source
E.Coli
Origin
Mus musculus (Mouse)
Field of Research
Immunology & Inflammation
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
> 97% as determined by SDS-PAGE and HPLC.
Bioactivity
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood neutrophils is in a concentration range of 10-100 ng/ml.
Form
Lyophilized powder
Molecular Weight
7.8 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm filtered PBS, pH 7.4
AA Sequence
APIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
H2033-15E 1 mL
Herpes Simplex Virus I, Glycoprotein D (HSV I, gD) discontinued
Sign In for Pricing
View Details 
MBS6408636-01 0.1 mL
BMI1 (Polycomb Group RING Finger Protein 4, Polycomb Complex Protein BMI 1, RING Finger Protein 51, RNF51, PCGF4) (HRP)
Sign In for Pricing
View Details MBS6408636-02 5x 0.1 mL
BMI1 (Polycomb Group RING Finger Protein 4, Polycomb Complex Protein BMI 1, RING Finger Protein 51, RNF51, PCGF4) (HRP)
Sign In for Pricing
View Details