Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Monkey CCL11 protein (Active)

This Monkey CCL11 protein (Active) spans the amino acid sequence from region 24-97aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

C-C motif chemokine 11

UniProt

Q8MIT7

Expression Region

24-97aa

Tag

Tag-Free

Source

E.Coli

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 98% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood eosinophils is in a concentration range of 0.1-10.0 ng/ml.

Form

Lyophilized powder

Molecular Weight

8.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

GPDSVATTCCFTLTNKKIPLQRLESYRRIISGKCPQKAVIFKTKLAKDICADPKKKWVQDSMKYLDRKSPTPKP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FLVCR2 Protein Vector (Human) (pPB-C-His)
PV016481 500 ng

FLVCR2 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
LINC02693 Human Gene Knockout Kit (CRISPR)
KN425265 1 Kit

LINC02693 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HER3/ERBB3 Protein, Human, Recombinant (hFc), Biotinylated
TMPY-05753-01 5 µg

HER3/ERBB3 Protein, Human, Recombinant (hFc), Biotinylated

Sign In for Pricing
View Details
HER3/ERBB3 Protein, Human, Recombinant (hFc), Biotinylated
TMPY-05753-02 10 µg

HER3/ERBB3 Protein, Human, Recombinant (hFc), Biotinylated

Sign In for Pricing
View Details
HER3/ERBB3 Protein, Human, Recombinant (hFc), Biotinylated
TMPY-05753-03 20 µg

HER3/ERBB3 Protein, Human, Recombinant (hFc), Biotinylated

Sign In for Pricing
View Details
HER3/ERBB3 Protein, Human, Recombinant (hFc), Biotinylated
TMPY-05753-04 50 µg

HER3/ERBB3 Protein, Human, Recombinant (hFc), Biotinylated

Sign In for Pricing
View Details