Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CCL28 protein (Active)

This Human CCL28 protein (Active) spans the amino acid sequence from region 20-127aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Mucosae-associated epithelial chemokine, Protein CCK1, Small-inducible cytokine A28

UniProt

Q9NRJ3

Expression Region

20-127aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human lymphocytes is in a concentration range of 1.0-10.0 ng/ml.

Form

Lyophilized powder

Molecular Weight

12.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

SEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NF-kappa-B Inhibitor α (NFKBIA) Porcine ELISA Kit
F3813 96 Tests

NF-kappa-B Inhibitor α (NFKBIA) Porcine ELISA Kit

Sign In for Pricing
View Details
Canine Progesterone-induced-blocking factor 1 ELISA kit
GTR10399856 96 Well

Canine Progesterone-induced-blocking factor 1 ELISA kit

Sign In for Pricing
View Details
Rabbit Anti-AXIN1 Polyclonal Antibody
PAV524 100 μL

Rabbit Anti-AXIN1 Polyclonal Antibody

Sign In for Pricing
View Details
SIRPB2 Rabbit Polyclonal Antibody (PE)
orb492902 100 µL

SIRPB2 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
RAPGEF5 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV694624 1.0 µg DNA

RAPGEF5 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
ALDH1A1 Antibody [F4F17]
C21627-20uL 20 µL

ALDH1A1 Antibody [F4F17]

Sign In for Pricing
View Details