Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CCL28 protein (Active)

This Human CCL28 protein (Active) spans the amino acid sequence from region 20-127aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Mucosae-associated epithelial chemokine, Protein CCK1, Small-inducible cytokine A28

UniProt

Q9NRJ3

Expression Region

20-127aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human lymphocytes is in a concentration range of 1.0-10.0 ng/ml.

Form

Lyophilized powder

Molecular Weight

12.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

SEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

anti-Nesprin 1
YF-PA25868 50 ul

anti-Nesprin 1

Sign In for Pricing
View Details
Olr862-set siRNA/shRNA/RNAi Lentivector (Rat)
34749096 4x 500 ng

Olr862-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Canine C-Reactive Protein, CRP ELISA Kit
CSB-E14262c-01 96 Tests

Canine C-Reactive Protein, CRP ELISA Kit

Sign In for Pricing
View Details
Canine C-Reactive Protein, CRP ELISA Kit
CSB-E14262c-02 5x 96 Tests

Canine C-Reactive Protein, CRP ELISA Kit

Sign In for Pricing
View Details
Canine C-Reactive Protein, CRP ELISA Kit
CSB-E14262c-03 10x 96 Tests

Canine C-Reactive Protein, CRP ELISA Kit

Sign In for Pricing
View Details
PCMV-Vdac1-3xFLAG-Neo Plasmid
PVT83768 2 µg

PCMV-Vdac1-3xFLAG-Neo Plasmid

Sign In for Pricing
View Details