Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CCL20 protein (Active)

This Human CCL20 protein (Active) spans the amino acid sequence from region 27-96aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Beta-chemokine exodus-1, Liver and activation-regulated chemokine, Macrophage inflammatory protein 3 alpha, MIP-3-alpha, Small-inducible cytokine A20

UniProt

P78556

Expression Region

27-96aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration range of 10-50 ng/ml.

Form

Lyophilized powder

Molecular Weight

8.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered concentrated solution in 20 mM PB, pH 7.4, 100 mM NaCl.

AA Sequence

ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm884 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3096106 1.0 µg DNA

Gm884 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Rat Ntxi (Cross Linked N-Telopeptide of Type I Collagen) ELISA Kit
FY-ER2220 96 Well

Rat Ntxi (Cross Linked N-Telopeptide of Type I Collagen) ELISA Kit

Sign In for Pricing
View Details
ARHGDIG Antibody
42-820 0.1 mg

ARHGDIG Antibody

Sign In for Pricing
View Details
Foxm1 3'UTR GFP Stable Cell Line
TU156697 1.0 mL

Foxm1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Rat Anti-Mouse CD38, Antibody
GWB-6241CF 0.5 mg

Rat Anti-Mouse CD38, Antibody

Sign In for Pricing
View Details
Qrfp sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
38269114 3x 1.0 µg

Qrfp sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details