Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CCL14 protein (Active)

This Human CCL14 protein (Active) spans the amino acid sequence from region 28-93aa. Purity: > 95% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Chemokine CC-1/CC-3, HCC-11-74 NCC-2, Small-inducible cytokine A14

UniProt

Q16627

Expression Region

28-93aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 95% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 5.0-20 ng/ml.

Form

Lyophilized powder

Molecular Weight

7.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

GPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL7AP3 Protein Vector (Human) (pPB-C-His)
PV123882 500 ng

RPL7AP3 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
PC5/6 CRISPR Activation Plasmid (h)
sc-407924-ACT 20 µg

PC5/6 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Rabbit Polyclonal HR6A/UBE2A Antibody
NBP2-54946-25ul 25 µL

Rabbit Polyclonal HR6A/UBE2A Antibody

Sign In for Pricing
View Details
TCEB3B Polyclonal Antibody
E-AB-62443-01 60 µL

TCEB3B Polyclonal Antibody

Sign In for Pricing
View Details
TCEB3B Polyclonal Antibody
E-AB-62443-02 120 µL

TCEB3B Polyclonal Antibody

Sign In for Pricing
View Details
TCEB3B Polyclonal Antibody
E-AB-62443-03 200 µL

TCEB3B Polyclonal Antibody

Sign In for Pricing
View Details