Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CCL14 protein (Active)

This Human CCL14 protein (Active) spans the amino acid sequence from region 28-93aa. Purity: > 95% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Chemokine CC-1/CC-3, HCC-11-74 NCC-2, Small-inducible cytokine A14

UniProt

Q16627

Expression Region

28-93aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 95% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 5.0-20 ng/ml.

Form

Lyophilized powder

Molecular Weight

7.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

GPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) EXPA12 Polyclonal Antibody
MBS9011868 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) EXPA12 Polyclonal Antibody

Sign In for Pricing
View Details
Bovine SRY (Sex-determining region Y protein) ELISA Kit
orb1953015-01 48 Tests

Bovine SRY (Sex-determining region Y protein) ELISA Kit

Sign In for Pricing
View Details
Bovine SRY (Sex-determining region Y protein) ELISA Kit
orb1953015-02 96 Tests

Bovine SRY (Sex-determining region Y protein) ELISA Kit

Sign In for Pricing
View Details
THOC5 (NM_001002877) Human Tagged ORF Clone Lentiviral Particle
RC213773L3V 200 µL

THOC5 (NM_001002877) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
OPALIN Polyclonal Antibody, Biotin Conjugated
A66325-100 100 µL

OPALIN Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
RLIM Adenovirus (Rat)
39624056 1.0 mL

RLIM Adenovirus (Rat)

Sign In for Pricing
View Details